Class b: All beta proteins [48724] (178 folds) |
Fold b.106: Phage tail proteins [69278] (1 superfamily) core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel |
Superfamily b.106.1: Phage tail proteins [69279] (4 families) |
Family b.106.1.0: automated matches [356579] (1 protein) not a true family |
Protein automated matches [356580] (1 species) not a true protein |
Species Peptoclostridium difficile [TaxId:272563] [356581] (1 PDB entry) |
Domain d6gkxa_: 6gkx A: [356582] automated match to d2gujb_ |
PDB Entry: 6gkx (more details), 1.5 Å
SCOPe Domain Sequences for d6gkxa_:
Sequence, based on SEQRES records: (download)
>d6gkxa_ b.106.1.0 (A:) automated matches {Peptoclostridium difficile [TaxId: 272563]} rnvmsgtwgelwldgnkvaevkkfqakmeftkediiiagqmgtdtkymgykgkgsitlyh vssrmhkligekikrgseprfvaisklndpdsygaeriavkniafddltladwevgvkge ieapftfteydfldii
>d6gkxa_ b.106.1.0 (A:) automated matches {Peptoclostridium difficile [TaxId: 272563]} rnvmsgtwgelwldgnkvaevkkfqakmeftkediiiagqmgtkymgykgkgsitlyhvs srmhkligekikrgseprfvaisklndpdsygaeriavkniafddltladwevgvkgeie apftfteydfldii
Timeline for d6gkxa_: