SCOPe 2.07: Domain d6gkxa_: 6gkx A:

Lineage for d6gkxa_ (6gkx A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.106: Phage tail proteins [69278] (1 superfamily)
   core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel

4. Superfamily b.106.1: Phage tail proteins [69279] (4 families)

5. Family b.106.1.0: automated matches [356579] (1 protein)
   not a true family

6. Protein automated matches [356580] (1 species)
   not a true protein

7. Species Peptoclostridium difficile [TaxId:272563] [356581] (1 PDB entry)

8. Domain d6gkxa_: 6gkx A: [356582]
   automated match to d2gujb_

Details for d6gkxa_

PDB Entry: 6gkx, 1.5 Å

PDB Description: crystal structure of the r-type bacteriocin tube protein cd1364 from clostridium difficile in the pre-assembled state

PDB Compounds: (A:) Putative phage XkdM-like protein

SCOPe Domain Sequences for d6gkxa_:

Sequence, based on SEQRES records:

>d6gkxa_ b.106.1.0 (A:) automated matches {Peptoclostridium difficile [TaxId: 272563]}
rnvmsgtwgelwldgnkvaevkkfqakmeftkediiiagqmgtdtkymgykgkgsitlyh
vssrmhkligekikrgseprfvaisklndpdsygaeriavkniafddltladwevgvkge
ieapftfteydfldii

Sequence, based on observed residues (ATOM records):

>d6gkxa_ b.106.1.0 (A:) automated matches {Peptoclostridium difficile [TaxId: 272563]}
rnvmsgtwgelwldgnkvaevkkfqakmeftkediiiagqmgtkymgykgkgsitlyhvs
srmhkligekikrgseprfvaisklndpdsygaeriavkniafddltladwevgvkgeie
apftfteydfldii

Timeline for d6gkxa_:

• d6gkxa_ is new in SCOPe 2.07-stable
  
• d6gkxa_ appears in the current release, SCOPe 2.08