Lineage for d6ebld_ (6ebl D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552337Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2552338Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2552678Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2552679Protein automated matches [190710] (5 species)
    not a true protein
  7. 2552839Species Rattus norvegicus [TaxId:10116] [356377] (1 PDB entry)
  8. 2552841Domain d6ebld_: 6ebl D: [356532]
    Other proteins in same PDB: d6ebla_, d6eblc_, d6eble_, d6eblg_
    automated match to d1t1da_
    complexed with nap

Details for d6ebld_

PDB Entry: 6ebl (more details), 3 Å

PDB Description: the voltage-activated kv1.2-2.1 paddle chimera channel in lipid nanodiscs, cytosolic domain
PDB Compounds: (D:) Potassium voltage-gated channel subfamily A member 2,Potassium voltage-gated channel subfamily B member 2 chimera

SCOPe Domain Sequences for d6ebld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ebld_ d.42.1.0 (D:) automated matches {Rattus norvegicus [TaxId: 10116]}
ccervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdaily
yyqsggrlrrpvnvpldifseeirfyelgeeamemfredegy

SCOPe Domain Coordinates for d6ebld_:

Click to download the PDB-style file with coordinates for d6ebld_.
(The format of our PDB-style files is described here.)

Timeline for d6ebld_: