SCOPe 2.07: Domain d6h6qa_: 6h6q A:

Lineage for d6h6qa_ (6h6q A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein automated matches [190700] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187840] (48 PDB entries)

8. Domain d6h6qa_: 6h6q A: [356514]
   automated match to d2opza_
   complexed with fuk, zn

Details for d6h6qa_

PDB Entry: 6h6q, 2.63 Å

PDB Description: fragment derived xiap inhibitor

PDB Compounds: (A:) E3 ubiquitin-protein ligase XIAP

SCOPe Domain Sequences for d6h6qa_:

Sequence; same for both SEQRES and ATOM records:

>d6h6qa_ g.52.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcggglt
dwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvr

Timeline for d6h6qa_:

• d6h6qa_ is new in SCOPe 2.07-stable
  
• d6h6qa_ appears in the current release, SCOPe 2.08