SCOPe 2.07: Domain d6g5aa_: 6g5a A:

Lineage for d6g5aa_ (6g5a A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (10 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (316 PDB entries)
   Uniprot P02185

8. Domain d6g5aa_: 6g5a A: [356409]
   automated match to d2mgja_
   complexed with eee, hem

Details for d6g5aa_

PDB Entry: 6g5a, 1.48 Å

PDB Description: heme-carbene complex in myoglobin h64v/v68a containing an n- methylhistidine as the proximal ligand, 1.48 angstrom resolution

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d6g5aa_:

Sequence; same for both SEQRES and ATOM records:

>d6g5aa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkvgvtaltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d6g5aa_:

• d6g5aa_ is new in SCOPe 2.07-stable
  
• d6g5aa_ appears in the current release, SCOPe 2.08