Lineage for d6drvb3 (6drv B:335-626)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2441004Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2441005Protein automated matches [190075] (125 species)
    not a true protein
  7. 2441316Species Escherichia coli [TaxId:83333] [272137] (17 PDB entries)
  8. 2441326Domain d6drvb3: 6drv B:335-626 [356403]
    Other proteins in same PDB: d6drva1, d6drva2, d6drva4, d6drva5, d6drvb1, d6drvb2, d6drvb4, d6drvb5, d6drvc1, d6drvc2, d6drvc4, d6drvc5
    automated match to d1jz7a5

Details for d6drvb3

PDB Entry: 6drv (more details), 2.2 Å

PDB Description: beta-galactosidase
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d6drvb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6drvb3 c.1.8.0 (B:335-626) automated matches {Escherichia coli [TaxId: 83333]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d6drvb3:

Click to download the PDB-style file with coordinates for d6drvb3.
(The format of our PDB-style files is described here.)

Timeline for d6drvb3: