Lineage for d6aq6b_ (6aq6 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2387950Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2388157Protein Legume lectin [49904] (23 species)
  7. 2388180Species Cockspur coral tree (Erythrina crista-galli) [TaxId:49817] [74903] (7 PDB entries)
    Uniprot Q6YD91
  8. 2388194Domain d6aq6b_: 6aq6 B: [356375]
    automated match to d1v00c_
    complexed with act, bma, ca, fuc, gal, man, mn, na, nag, xyp

Details for d6aq6b_

PDB Entry: 6aq6 (more details), 1.9 Å

PDB Description: x-ray crystal structure of erythrina crista-galli lectin in complex with n-acetyllactosamine
PDB Compounds: (B:) lectin

SCOPe Domain Sequences for d6aq6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aq6b_ b.29.1.1 (B:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]}
vetisfsfsefepgnndltlqgaaiitqsgvlqltkinqngmpawdstgrtlytkpvhiw
dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgvfnnskqdns
yqtlavefdtfsnpwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskill
avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfhaslpe

SCOPe Domain Coordinates for d6aq6b_:

Click to download the PDB-style file with coordinates for d6aq6b_.
(The format of our PDB-style files is described here.)

Timeline for d6aq6b_: