SCOPe 2.07: Domain d6ap9b2: 6ap9 B:77-209

Lineage for d6ap9b2 (6ap9 B:77-209)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47619] (66 PDB entries)

8. Domain d6ap9b2: 6ap9 B:77-209 [356333]
   Other proteins in same PDB: d6ap9a1, d6ap9b1
   automated match to d13gsa1
   complexed with act, ca, gds, gsh, mes

Details for d6ap9b2

PDB Entry: 6ap9, 1.55 Å

PDB Description: crystal structure of hgstp1-1 with s-nitrosation of cys101

PDB Compounds: (B:) Glutathione S-transferase P

SCOPe Domain Sequences for d6ap9b2:

Sequence; same for both SEQRES and ATOM records:

>d6ap9b2 a.45.1.1 (B:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

Timeline for d6ap9b2:

• d6ap9b2 is new in SCOPe 2.07-stable
  
• d6ap9b2 appears in the current release, SCOPe 2.08