SCOPe 2.07: Domain d6aa7a_: 6aa7 A:

Lineage for d6aa7a_ (6aa7 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (25 species)
   not a true protein

7. Species Acropora digitifera [TaxId:70779] [356323] (1 PDB entry)

8. Domain d6aa7a_: 6aa7 A: [356325]
   automated match to d2ojka_

Details for d6aa7a_

PDB Entry: 6aa7, 1.8 Å

PDB Description: fluorescent protein from acropora digitifera

PDB Compounds: (A:) fluorescent protein

SCOPe Domain Sequences for d6aa7a_:

Sequence; same for both SEQRES and ATOM records:

>d6aa7a_ d.22.1.0 (A:) automated matches {Acropora digitifera [TaxId: 70779]}
lskhgltkdmtmkyrmegcvdghkfvitghgngspfegkqtinlcvveggplpfsedils
avfdygnrvftdypqgmvdffknscpagytwqrsllfedgavctasaditvsveencfyh
eskfhgvnfpadgpvmkkmtinwepccekiipvprqgilkgdvamylllkdggryrcqfd
tvykaktdskkmpewhfiqhkltredrsdaknqkwqlaehsvasrsala

Timeline for d6aa7a_:

• d6aa7a_ is new in SCOPe 2.07-stable
  
• d6aa7a_ appears in the current release, SCOPe 2.08