Lineage for d5z86e_ (5z86 E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727193Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) (S)
    automatically mapped to Pfam PF02284
  5. 2727194Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)
  6. 2727195Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 2727196Species Cow (Bos taurus) [TaxId:9913] [48482] (50 PDB entries)
  8. 2727246Domain d5z86e_: 5z86 E: [356305]
    Other proteins in same PDB: d5z86a_, d5z86b1, d5z86b2, d5z86c_, d5z86d_, d5z86f_, d5z86g_, d5z86h_, d5z86i_, d5z86j_, d5z86k_, d5z86l_, d5z86m_, d5z86n_, d5z86o1, d5z86o2, d5z86p_, d5z86q_, d5z86s_, d5z86t_, d5z86u_, d5z86v_, d5z86w_, d5z86x_, d5z86y_, d5z86z_
    automated match to d1ocre_
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5z86e_

PDB Entry: 5z86 (more details), 1.85 Å

PDB Description: azide-bound cytochrome c oxidase structure determined using the crystals exposed to 20 mm azide solution for 3 days
PDB Compounds: (E:) cytochrome c oxidase subunit 5a, mitochondrial

SCOPe Domain Sequences for d5z86e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z86e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d5z86e_:

Click to download the PDB-style file with coordinates for d5z86e_.
(The format of our PDB-style files is described here.)

Timeline for d5z86e_: