Lineage for d5z85p_ (5z85 P:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2579677Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 2579678Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (1 family) (S)
    automatically mapped to Pfam PF00510
  5. 2579679Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 2579692Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)
  7. 2579693Species Cow (Bos taurus) [TaxId:9913] [81444] (48 PDB entries)
  8. 3056212Domain d5z85p_: 5z85 P: [356274]
    Other proteins in same PDB: d5z85a_, d5z85b1, d5z85b2, d5z85d_, d5z85e_, d5z85f_, d5z85g_, d5z85h_, d5z85i_, d5z85j_, d5z85k_, d5z85l_, d5z85m_, d5z85o1, d5z85o2, d5z85q_, d5z85s_, d5z85t_, d5z85u_, d5z85v_, d5z85w_, d5z85x_, d5z85y_, d5z85z_
    automated match to d2occc_
    complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5z85p_

PDB Entry: 5z85 (more details), 1.85 Å

PDB Description: the structure of azide-bound cytochrome c oxidase determined using the another batch crystals exposed to 20 mm azide solution for 2 days
PDB Compounds: (P:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d5z85p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z85p_ f.25.1.1 (P:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

SCOPe Domain Coordinates for d5z85p_:

Click to download the PDB-style file with coordinates for d5z85p_.
(The format of our PDB-style files is described here.)

Timeline for d5z85p_:

  • d5z85p_ appears in periodic updates to SCOPe 2.07 starting on 2018-08-16