Lineage for d1g21b_ (1g21 B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 403170Fold c.92: Chelatase-like [53799] (2 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 403193Superfamily c.92.2: "Helical backbone" metal receptor [53807] (3 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 403222Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (2 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
  6. 403262Protein Nitrogenase iron-molybdenum protein, beta chain [81401] (3 species)
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
  7. 403263Species Azotobacter vinelandii [TaxId:354] [81397] (10 PDB entries)
  8. 403283Domain d1g21b_: 1g21 B: [35622]
    Other proteins in same PDB: d1g21a_, d1g21c_, d1g21e_, d1g21f_, d1g21g_, d1g21h_

Details for d1g21b_

PDB Entry: 1g21 (more details), 3 Å

PDB Description: mgatp-bound and nucleotide-free structures of a nitrogenase protein complex between leu127del-fe protein and the mofe protein

SCOP Domain Sequences for d1g21b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g21b_ c.92.2.3 (B:) Nitrogenase iron-molybdenum protein, beta chain {Azotobacter vinelandii}
sqqvdkikasyplfldqdykdmlakkrdgfeekypqdkidevfqwtttkeyqelnfqrea
ltvnpakacqplgavlcalgfektmpyvhgsqgcvayfrsyfnrhfrepvscvsdsmted
aavfggqqnmkdglqnckatykpdmiavsttcmaevigddlnafinnskkegfipdefpv
pfahtpsfvgshvtgwdnmfegiaryftlksmddkvvgsnkkinivpgfetylgnfrvik
rmlsemgvgysllsdpeevldtpadgqfrmyaggttqeemkdapnalntvllqpwhlekt
kkfvegtwkhevpklnipmgldwtdeflmkvseisgqpipasltkergrlvdmmtdshtw
lhgkrfalwgdpdfvmglvkfllelgcepvhilchngnkrwkkavdailaaspygknatv
yigkdlwhlrslvftdkpdfmignsygkfiqrdtlhkgkefevplirigfpifdrhhlhr
sttlgyegamqilttlvnsilerldeetrgmqatdynhdlvr

SCOP Domain Coordinates for d1g21b_:

Click to download the PDB-style file with coordinates for d1g21b_.
(The format of our PDB-style files is described here.)

Timeline for d1g21b_: