Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) |
Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
Protein Mitochondrial cytochrome c oxidase, subunit I [81433] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [81432] (40 PDB entries) |
Domain d5zcpn_: 5zcp N: [356150] Other proteins in same PDB: d5zcpb1, d5zcpb2, d5zcpc_, d5zcpd_, d5zcpe_, d5zcpf_, d5zcpg_, d5zcph_, d5zcpi_, d5zcpj_, d5zcpk_, d5zcpl_, d5zcpm_, d5zcpo1, d5zcpo2, d5zcpp_, d5zcpq_, d5zcpr_, d5zcps_, d5zcpt_, d5zcpu_, d5zcpv_, d5zcpw_, d5zcpx_, d5zcpy_, d5zcpz_ automated match to d1v54a_ complexed with azi, cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 5zcp (more details), 1.65 Å
SCOPe Domain Sequences for d5zcpn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zcpn_ f.24.1.1 (N:) Mitochondrial cytochrome c oxidase, subunit I {Cow (Bos taurus) [TaxId: 9913]} mfinrwlfstnhkdigtlyllfgawagmvgtalslliraelgqpgtllgddqiynvvvta hafvmiffmvmpimiggfgnwlvplmigapdmafprmnnmsfwllppsfllllassmvea gagtgwtvypplagnlahagasvdltifslhlagvssilgainfittiinmkppamsqyq tplfvwsvmitavllllslpvlaagitmlltdrnlnttffdpagggdpilyqhlfwffgh pevyililpgfgmishivtyysgkkepfgymgmvwammsigflgfivwahhmftvgmdvd trayftsatmiiaiptgvkvfswlatlhggnikwspammwalgfiflftvggltgivlan ssldivlhdtyyvvahfhyvlsmgavfaimggfvhwfplfsgytlndtwakihfaimfvg vnmtffpqhflglsgmprrysdypdaytmwntissmgsfisltavmlmvfiiweafaskr evltvdltttnlewlngcpppyhtfeeptyvnlk
Timeline for d5zcpn_:
View in 3D Domains from other chains: (mouse over for more information) d5zcpa_, d5zcpb1, d5zcpb2, d5zcpc_, d5zcpd_, d5zcpe_, d5zcpf_, d5zcpg_, d5zcph_, d5zcpi_, d5zcpj_, d5zcpk_, d5zcpl_, d5zcpm_, d5zcpo1, d5zcpo2, d5zcpp_, d5zcpq_, d5zcpr_, d5zcps_, d5zcpt_, d5zcpu_, d5zcpv_, d5zcpw_, d5zcpx_, d5zcpy_, d5zcpz_ |