SCOPe 2.07: Domain d6f05g1: 6f05 G:3-80

Lineage for d6f05g1 (6f05 G:3-80)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (34 PDB entries)

8. Domain d6f05g1: 6f05 G:3-80 [356107]
   Other proteins in same PDB: d6f05a2, d6f05b2, d6f05c2, d6f05d2, d6f05e2, d6f05f2, d6f05g2, d6f05h2, d6f05i2, d6f05j2
   automated match to d1aw9a2
   complexed with cl, gol, gts

Details for d6f05g1

PDB Entry: 6f05, 2.2 Å

PDB Description: arabidopsis thaliana gstf9, gso3 bound

PDB Compounds: (G:) Glutathione S-transferase F9

SCOPe Domain Sequences for d6f05g1:

Sequence; same for both SEQRES and ATOM records:

>d6f05g1 c.47.1.0 (G:3-80) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lkvygphfaspkralvtliekgvafetipvdlmkgehkqpaylalqpfgtvpavvdgdyk
ifesravmryvaekyrsq

Timeline for d6f05g1:

• d6f05g1 is new in SCOPe 2.07-stable
  
• d6f05g1 appears in the current release, SCOPe 2.08