Lineage for d6ffje1 (6ffj E:9-124)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2367541Domain d6ffje1: 6ffj E:9-124 [356083]
    Other proteins in same PDB: d6ffja3, d6ffjc3, d6ffje3, d6ffjg3
    automated match to d5gruh1

Details for d6ffje1

PDB Entry: 6ffj (more details), 2.2 Å

PDB Description: anti-tumor antibody 14f7-derived single chain fragment variable (scfv)
PDB Compounds: (E:) 14F7-derived scFv

SCOPe Domain Sequences for d6ffje1:

Sequence, based on SEQRES records: (download)

>d6ffje1 b.1.1.0 (E:9-124) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aelakpgasmkmscrasgysftsywihwlkqrpdqglewigyidpataytesnqkfkdka
iltadrssntafmylnsltsedsavyycaresprlrrgiyyyamdywgqgttvtvs

Sequence, based on observed residues (ATOM records): (download)

>d6ffje1 b.1.1.0 (E:9-124) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aelakpgasmkmscrasgysftsywihwlkqrpdqglewigyidpataytesnqkfkdka
iltadrssntafmylnsltsedsavyycarespyyyamdywgqgttvtvs

SCOPe Domain Coordinates for d6ffje1:

Click to download the PDB-style file with coordinates for d6ffje1.
(The format of our PDB-style files is described here.)

Timeline for d6ffje1: