Lineage for d6flzb_ (6flz B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2422560Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2422610Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2422754Family b.77.3.0: automated matches [191397] (1 protein)
    not a true family
  6. 2422755Protein automated matches [190516] (5 species)
    not a true protein
  7. 2422756Species Ananas comosus [TaxId:4615] [356037] (3 PDB entries)
  8. 2422762Domain d6flzb_: 6flz B: [356048]
    automated match to d5gvya_
    complexed with cit, mma

Details for d6flzb_

PDB Entry: 6flz (more details), 1.9 Å

PDB Description: structure of acmjrl, a mannose binding jacalin related lectin from ananas comosus, in complex with methyl-mannose.
PDB Compounds: (B:) Jacalin-like lectin

SCOPe Domain Sequences for d6flzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6flzb_ b.77.3.0 (B:) automated matches {Ananas comosus [TaxId: 4615]}
sglvklglwggnegtlqdidghptrltkivirsahaidalqfdyvedgktfaagqwggng
gksdtiefqpgeyliaikgttgalgavtnlvrsltfisnmrtygpfglehgtpfsvpvas
grivafygrfgslvdafgiylmpy

SCOPe Domain Coordinates for d6flzb_:

Click to download the PDB-style file with coordinates for d6flzb_.
(The format of our PDB-style files is described here.)

Timeline for d6flzb_: