Lineage for d6c7id_ (6c7i D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349642Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2349643Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2350180Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2350181Protein automated matches [190983] (10 species)
    not a true protein
  7. 2350200Species Human (Homo sapiens) [TaxId:9606] [188676] (136 PDB entries)
  8. 2350300Domain d6c7id_: 6c7i D: [356016]
    Other proteins in same PDB: d6c7ia2, d6c7ib2
    automated match to d5vp0b_
    complexed with ep7, mg, zn

Details for d6c7id_

PDB Entry: 6c7i (more details), 1.71 Å

PDB Description: crystal structure of human phosphodiesterase 2a with 1-(2-chloro-5- methoxy-phenyl)-n-isobutyl-4-methyl-[1,2,4]triazolo[4,3- a]quinoxaline-8-carboxamide
PDB Compounds: (D:) cGMP-dependent 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d6c7id_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c7id_ a.211.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptla
rfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdldh
rgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmldl
mrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkttr
kiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfpk
aaelyervasnrehwtkvshkftirglpsnnsldfld

SCOPe Domain Coordinates for d6c7id_:

Click to download the PDB-style file with coordinates for d6c7id_.
(The format of our PDB-style files is described here.)

Timeline for d6c7id_: