Class a: All alpha proteins [46456] (289 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) |
Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
Protein automated matches [190983] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188676] (136 PDB entries) |
Domain d6c7id_: 6c7i D: [356016] Other proteins in same PDB: d6c7ia2, d6c7ib2 automated match to d5vp0b_ complexed with ep7, mg, zn |
PDB Entry: 6c7i (more details), 1.71 Å
SCOPe Domain Sequences for d6c7id_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6c7id_ a.211.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eytkllhdgiqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptla rfclmvkkgyrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdldh rgtnnsfqvasksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmldl mrdiilatdlahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkttr kiaeliykeffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfpk aaelyervasnrehwtkvshkftirglpsnnsldfld
Timeline for d6c7id_: