SCOPe 2.07: Domain d6an6b_: 6an6 B:

Lineage for d6an6b_ (6an6 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family)
   common fold is elaborated with additional secondary structures
   automatically mapped to Pfam PF01288

5. Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (2 proteins)

6. Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (4 species)

7. Species Escherichia coli [TaxId:562] [55086] (42 PDB entries)
   Uniprot P26281

8. Domain d6an6b_: 6an6 B: [355978]
   automated match to d1q0na_
   complexed with j1i

Details for d6an6b_

PDB Entry: 6an6, 2.3 Å

PDB Description: crystal structure of escherichia coli hppk in complex with bisubstrate analogue inhibitor hp-72

PDB Compounds: (B:) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase

SCOPe Domain Sequences for d6an6b_:

Sequence; same for both SEQRES and ATOM records:

>d6an6b_ d.58.30.1 (B:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli [TaxId: 562]}
tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw

Timeline for d6an6b_:

• d6an6b_ is new in SCOPe 2.07-stable
  
• d6an6b_ appears in the current release, SCOPe 2.08