SCOPe 2.07: Domain d6dw1b_: 6dw1 B:

Lineage for d6dw1b_ (6dw1 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [259757] (11 PDB entries)

8. Domain d6dw1b_: 6dw1 B: [355766]
   automated match to d4uy2a_
   complexed with abu, bma, man, nag

Details for d6dw1b_

PDB Entry: 6dw1, 3.1 Å

PDB Description: cryo-em structure of the benzodiazepine-sensitive alpha1beta1gamma2s tri-heteromeric gabaa receptor in complex with gaba (ecd map)

PDB Compounds: (B:) Gamma-aminobutyric acid receptor subunit beta-1,Gamma-aminobutyric acid receptor subunit beta-1

SCOPe Domain Sequences for d6dw1b_:

Sequence; same for both SEQRES and ATOM records:

>d6dw1b_ b.96.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nmsyvketvdrllkgydirlrpdfggppvdvgmridvasidmvsevnmdytltmyfqqsw
kdkrlsysgiplnltldnrvadqlwvpdtyflndkksfvhgvtvknrmirlhpdgtvlyg
lritttaacmmdlrrypldeqnctleiesygyttddiefywnggegavtgvnkielpqfs
ivdykmvskkvefttgayprlslsfrlkrn

Timeline for d6dw1b_:

• d6dw1b_ is new in SCOPe 2.07-stable
  
• d6dw1b_ appears in the current release, SCOPe 2.08