SCOPe 2.07: Domain d5obgb_: 5obg B:

Lineage for d5obgb_ (5obg B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)

8. Domain d5obgb_: 5obg B: [355651]
   automated match to d2w8gc_
   complexed with act, edo, na, nag, sy9

Details for d5obgb_

PDB Entry: 5obg, 2 Å

PDB Description: crystal structure of glycine binding protein in complex with strychnine

PDB Compounds: (B:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d5obgb_:

Sequence, based on SEQRES records:

>d5obgb_ b.96.1.0 (B:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
lsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqvdlssyyasskyeilsatqt
rqvqhykgtgepyidvnlvvkfrerragngff

Sequence, based on observed residues (ATOM records):

>d5obgb_ b.96.1.0 (B:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
lsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqvdlssyyasskyeilsatqt
rqvqhykgtgepyidvnlvvkfrerrff

Timeline for d5obgb_:

• d5obgb_ is new in SCOPe 2.07-stable
  
• d5obgb_ appears in the current release, SCOPe 2.08