SCOPe 2.07: Domain d5y07b_: 5y07 B:

Lineage for d5y07b_ (5y07 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (38 species)
   not a true protein

7. Species Yersinia pseudotuberculosis [TaxId:273123] [227797] (8 PDB entries)

8. Domain d5y07b_: 5y07 B: [355635]
   automated match to d4mb6a_
   complexed with mg, na, prp

Details for d5y07b_

PDB Entry: 5y07, 2.07 Å

PDB Description: crystal structure of adenine phosphoribosyltransferase from yersinia pseudotuberculosis with prpp.

PDB Compounds: (B:) Adenine phosphoribosyltransferase

SCOPe Domain Sequences for d5y07b_:

Sequence; same for both SEQRES and ATOM records:

>d5y07b_ c.61.1.0 (B:) automated matches {Yersinia pseudotuberculosis [TaxId: 273123]}
taqqlkyikdsiktipdypkagilfrdvtsllenpkaysasiellsehysesgvtkvvgt
eargflfgapvalalgvgfvpvrkpgklpretisesyeleygtdtleihtdsiqpgdkvl
vvddllatggtieatvklirrlggevvhaafiinlpelggearltqqgihcyslvsfd

Timeline for d5y07b_:

• d5y07b_ is new in SCOPe 2.07-stable
  
• d5y07b_ appears in the current release, SCOPe 2.08