Lineage for d5obhc_ (5obh C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2428807Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2428808Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2429246Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2429247Protein automated matches [193506] (5 species)
    not a true protein
  7. 2429248Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)
  8. 2429631Domain d5obhc_: 5obh C: [355598]
    automated match to d2w8gc_
    complexed with cl, j94, nag

Details for d5obhc_

PDB Entry: 5obh (more details), 2.4 Å

PDB Description: crystal structure of glycine binding protein in complex with bicuculline
PDB Compounds: (C:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d5obhc_:

Sequence, based on SEQRES records: (download)

>d5obhc_ b.96.1.0 (C:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
lsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqvdlssyyasskyeilsatqt
rqvqhykgtgepyidvnlvvkfrerragn

Sequence, based on observed residues (ATOM records): (download)

>d5obhc_ b.96.1.0 (C:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
lsfmcdptgvdseegvtcavkfeswvysgfeidlktdtdqvdlssyyasskyeilsatqt
rqvqhygepyidvnlvvkfrerragn

SCOPe Domain Coordinates for d5obhc_:

Click to download the PDB-style file with coordinates for d5obhc_.
(The format of our PDB-style files is described here.)

Timeline for d5obhc_: