SCOPe 2.07: Domain d6bhsa1: 6bhs A:1-147

Lineage for d6bhsa1 (6bhs A:1-147)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein automated matches [190369] (8 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 group m subtype b (isolate ny5) [TaxId:11698] [355560] (1 PDB entry)

8. Domain d6bhsa1: 6bhs A:1-147 [355561]
   Other proteins in same PDB: d6bhsa2
   automated match to d4xfxa1
   complexed with ihp

Details for d6bhsa1

PDB Entry: 6bhs, 1.98 Å

PDB Description: hiv-1 ca hexamer in complex with ip6, hexagonal crystal form

PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d6bhsa1:

Sequence, based on SEQRES records:

>d6bhsa1 a.73.1.1 (A:1-147) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate ny5) [TaxId: 11698]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records):

>d6bhsa1 a.73.1.1 (A:1-147) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate ny5) [TaxId: 11698]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhpiapgqmreprgsdiagttstlqeqigwmthnp
pipvgeiykrwiilglnkivrmysp

Timeline for d6bhsa1:

• d6bhsa1 is new in SCOPe 2.07-stable
  
• d6bhsa1 appears in the current release, SCOPe 2.08