SCOPe 2.07: Domain d6b1yb_: 6b1y B:

Lineage for d6b1yb_ (6b1y B:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [225260] (109 PDB entries)

8. Domain d6b1yb_: 6b1y B: [355407]
   automated match to d3c5aa_
   complexed with cd7, cl, so4

Details for d6b1yb_

PDB Entry: 6b1y, 1.8 Å

PDB Description: crystal structure kpc-2 beta-lactamase complexed with wck 5153 by co- crystallization

PDB Compounds: (B:) Carbapenem-hydrolyzing beta-lactamase KPC

SCOPe Domain Sequences for d6b1yb_:

Sequence; same for both SEQRES and ATOM records:

>d6b1yb_ e.3.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
ltnlvaepfakleqdfggsigvyamdtgsgatvsyraeerfplcssfkgflaaavlarsq
qqaglldtpirygknalvpwspisekylttgmtvaelsaaavqysdnaaanlllkelggp
agltafmrsigdttfrldrwelelnsaipgdardtsspravteslqkltlgsalaapqrq
qfvdwlkgnttgnhriraavpadwavgdktgtcgvygtandyavvwptgrapivlavytr
apnkddkhseaviaaaarlaleglg

Timeline for d6b1yb_:

• d6b1yb_ is new in SCOPe 2.07-stable
  
• d6b1yb_ appears in the current release, SCOPe 2.08