Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) the constituent families form similar dimers |
Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins) the active site is between the two identical subunits |
Protein NADP-dependent isocitrate dehydrogenase [82524] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [110715] (31 PDB entries) Uniprot O75874 |
Domain d6bkxa1: 6bkx A:3-414 [355254] Other proteins in same PDB: d6bkxa2, d6bkxb2, d6bkxc2 automated match to d1t0la_ complexed with ca, dwp, ict |
PDB Entry: 6bkx (more details), 1.65 Å
SCOPe Domain Sequences for d6bkxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bkxa1 c.77.1.1 (A:3-414) NADP-dependent isocitrate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} kkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkdaae aikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvs gwvkpiiigrhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvamgm ynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfeaq kiwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdgkt veaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanaleev sietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqakl
Timeline for d6bkxa1:
View in 3D Domains from other chains: (mouse over for more information) d6bkxb1, d6bkxb2, d6bkxc1, d6bkxc2 |