Lineage for d6bkxa1 (6bkx A:3-414)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513202Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2513203Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2513204Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2513298Protein NADP-dependent isocitrate dehydrogenase [82524] (2 species)
  7. 2513299Species Human (Homo sapiens) [TaxId:9606] [110715] (31 PDB entries)
    Uniprot O75874
  8. 2513300Domain d6bkxa1: 6bkx A:3-414 [355254]
    Other proteins in same PDB: d6bkxa2, d6bkxb2, d6bkxc2
    automated match to d1t0la_
    complexed with ca, dwp, ict

Details for d6bkxa1

PDB Entry: 6bkx (more details), 1.65 Å

PDB Description: novel modes of inhibition of wild-type idh1: direct covalent modification of his315 with cmpd1
PDB Compounds: (A:) isocitrate dehydrogenase [nadp] cytoplasmic

SCOPe Domain Sequences for d6bkxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bkxa1 c.77.1.1 (A:3-414) NADP-dependent isocitrate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
kkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkdaae
aikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvs
gwvkpiiigrhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvamgm
ynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfeaq
kiwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdgkt
veaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanaleev
sietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqakl

SCOPe Domain Coordinates for d6bkxa1:

Click to download the PDB-style file with coordinates for d6bkxa1.
(The format of our PDB-style files is described here.)

Timeline for d6bkxa1: