Class a: All alpha proteins [46456] (289 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.0: automated matches [238448] (1 protein) not a true family |
Protein automated matches [238450] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [238452] (7 PDB entries) |
Domain d5z30g_: 5z30 G: [355041] Other proteins in same PDB: d5z30b_, d5z30d_, d5z30f_ automated match to d1id3c_ protein/DNA complex; complexed with cl, mn; mutant |
PDB Entry: 5z30 (more details), 2.45 Å
SCOPe Domain Sequences for d5z30g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z30g_ a.22.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gkaktkavsrsqraglqfpvgrihrhlksrttshgrvgataavysaaileyltaevlela gnaskdlkvkcitprhlqlairgdeeldslikatiagggviphihkslig
Timeline for d5z30g_:
View in 3D Domains from other chains: (mouse over for more information) d5z30b_, d5z30c_, d5z30d_, d5z30f_ |