SCOPe 2.07: Domain d6fzua_: 6fzu A:

Lineage for d6fzua_ (6fzu A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.0: automated matches [191623] (1 protein)
   not a true family

6. Protein automated matches [191142] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189274] (104 PDB entries)

8. Domain d6fzua_: 6fzu A: [354965]
   automated match to d3l0la_
   complexed with ee8

Details for d6fzua_

PDB Entry: 6fzu, 1.8 Å

PDB Description: rorgt (264-518;c455s) in complex with the fragment ("cpd-1") and rip140 peptide at 1.80a

PDB Compounds: (A:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d6fzua_:

Sequence; same for both SEQRES and ATOM records:

>d6fzua_ a.123.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahh
lteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyg
gmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlq
ynlelafhhhlskthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyk
elfst

Timeline for d6fzua_:

• d6fzua_ is new in SCOPe 2.07-stable
  
• d6fzua_ appears in the current release, SCOPe 2.08