Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.22: ASF1-like [101546] (2 families) contains extra C-terminal strand automatically mapped to Pfam PF04729 |
Family b.1.22.0: automated matches [354818] (1 protein) not a true family |
Protein automated matches [354819] (1 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [354820] (1 PDB entry) |
Domain d6a6yb_: 6a6y B: [354931] automated match to d2cu9a1 complexed with edo, scn |
PDB Entry: 6a6y (more details), 2.49 Å
SCOPe Domain Sequences for d6a6yb_:
Sequence, based on SEQRES records: (download)
>d6a6yb_ b.1.22.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]} msevnvtkvivnnpicdildpfvftiefealnkleadlewkifyisavnnegesnqdiel dniflgpiergvmmfdyavnppdyknmdidsvlglqailisanykekefiriayymnsfy kdmelrenppvvpqydkicrhifvenprivkfsigwds
>d6a6yb_ b.1.22.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]} msevnvtkvivnnpicdildpfvftiefealnkleadlewkifyisavqdieldniflgp iergvmmfdyavnppdyknmdidsvlglqailisanykekefiriayymnsfykdmelre nppvvpqydkicrhifvenprivkfsigwds
Timeline for d6a6yb_: