SCOPe 2.07: Domain d6a6yb_: 6a6y B:

Lineage for d6a6yb_ (6a6y B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.22: ASF1-like [101546] (2 families)
   contains extra C-terminal strand
   automatically mapped to Pfam PF04729

5. Family b.1.22.0: automated matches [354818] (1 protein)
   not a true family

6. Protein automated matches [354819] (1 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [354820] (1 PDB entry)

8. Domain d6a6yb_: 6a6y B: [354931]
   automated match to d2cu9a1
   complexed with edo, scn

Details for d6a6yb_

PDB Entry: 6a6y, 2.49 Å

PDB Description: crystal structure of asf1 from plasmodium falciparum

PDB Compounds: (B:) Histone chaperone ASF1, putative

SCOPe Domain Sequences for d6a6yb_:

Sequence, based on SEQRES records:

>d6a6yb_ b.1.22.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
msevnvtkvivnnpicdildpfvftiefealnkleadlewkifyisavnnegesnqdiel
dniflgpiergvmmfdyavnppdyknmdidsvlglqailisanykekefiriayymnsfy
kdmelrenppvvpqydkicrhifvenprivkfsigwds

Sequence, based on observed residues (ATOM records):

>d6a6yb_ b.1.22.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
msevnvtkvivnnpicdildpfvftiefealnkleadlewkifyisavqdieldniflgp
iergvmmfdyavnppdyknmdidsvlglqailisanykekefiriayymnsfykdmelre
nppvvpqydkicrhifvenprivkfsigwds

Timeline for d6a6yb_:

• d6a6yb_ is new in SCOPe 2.07-stable
  
• d6a6yb_ appears in the current release, SCOPe 2.08