Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
Protein automated matches [190826] (22 species) not a true protein |
Species Acanthamoeba castellanii [TaxId:5755] [354894] (1 PDB entry) |
Domain d6fwhf1: 6fwh F:3-88 [354897] automated match to d1rhya1 complexed with 5ld, mg, mn |
PDB Entry: 6fwh (more details), 1.79 Å
SCOPe Domain Sequences for d6fwhf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fwhf1 d.14.1.0 (F:3-88) automated matches {Acanthamoeba castellanii [TaxId: 5755]} kreaqvaretgetkievrlsldgtgvsdvktgigfldhmlsalakhgrfdlylrcagdlh vddhhtsedcaivlgqafrqaigerk
Timeline for d6fwhf1: