Lineage for d6dbdc_ (6dbd C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355831Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)
  8. 2355938Domain d6dbdc_: 6dbd C: [354883]
    Other proteins in same PDB: d6dbdd2
    automated match to d4ocmc_
    complexed with act, na

Details for d6dbdc_

PDB Entry: 6dbd (more details), 1.76 Å

PDB Description: crystal structure of vhh r326
PDB Compounds: (C:) nanobody VHH R326

SCOPe Domain Sequences for d6dbdc_:

Sequence, based on SEQRES records: (download)

>d6dbdc_ b.1.1.1 (C:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvkleesggglvqaegslrlscvtsgriegillvgwyrqgpgkqrdvvasidrngntryd
gsaegrftiarenantvylqmnnlrpedsnvyvcgalssgvnpwawgqgtqvtvss

Sequence, based on observed residues (ATOM records): (download)

>d6dbdc_ b.1.1.1 (C:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvkleesggglvqaegslrlscvtsgriegillvgwyrqrdvvasidrngntrydgsaeg
rftiarenantvylqmnnlrpedsnvyvcgalssgvnpwawgqgtqvtvss

SCOPe Domain Coordinates for d6dbdc_:

Click to download the PDB-style file with coordinates for d6dbdc_.
(The format of our PDB-style files is described here.)

Timeline for d6dbdc_: