Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries) |
Domain d6dbdc_: 6dbd C: [354883] Other proteins in same PDB: d6dbdd2 automated match to d4ocmc_ complexed with act, na |
PDB Entry: 6dbd (more details), 1.76 Å
SCOPe Domain Sequences for d6dbdc_:
Sequence, based on SEQRES records: (download)
>d6dbdc_ b.1.1.1 (C:) automated matches {Llama (Lama glama) [TaxId: 9844]} qvkleesggglvqaegslrlscvtsgriegillvgwyrqgpgkqrdvvasidrngntryd gsaegrftiarenantvylqmnnlrpedsnvyvcgalssgvnpwawgqgtqvtvss
>d6dbdc_ b.1.1.1 (C:) automated matches {Llama (Lama glama) [TaxId: 9844]} qvkleesggglvqaegslrlscvtsgriegillvgwyrqrdvvasidrngntrydgsaeg rftiarenantvylqmnnlrpedsnvyvcgalssgvnpwawgqgtqvtvss
Timeline for d6dbdc_:
View in 3D Domains from other chains: (mouse over for more information) d6dbda_, d6dbdb_, d6dbdd1, d6dbdd2 |