Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.388: Filoviridae VP35-like [267590] (1 superfamily) consists of two subdomains: four-helix bundle; and a 4-stranded mixed beta sheet (order 1342), 2nd strand is very short |
Superfamily d.388.1: Filoviridae VP35-like [267597] (2 families) Pfam PF02097; PubMed 19122151 |
Family d.388.1.0: automated matches [354863] (1 protein) not a true family |
Protein automated matches [354864] (1 species) not a true protein |
Species Myotis lucifugus [TaxId:59463] [354865] (1 PDB entry) |
Domain d6dkua_: 6dku A: [354866] automated match to d4ijfa_ mutant |
PDB Entry: 6dku (more details), 2.6 Å
SCOPe Domain Sequences for d6dkua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6dkua_ d.388.1.0 (A:) automated matches {Myotis lucifugus [TaxId: 59463]} rlpldptefvrvltgyltgprtafhelvsaiamvsrdshdlqvamdhfnrelmdgfsaha aiisitqrceyfrnceapttqvtsksqiprayhrrlrdvpegpktlgrgwvyiyltpegs lglki
Timeline for d6dkua_: