Lineage for d6dkua_ (6dku A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2617803Fold d.388: Filoviridae VP35-like [267590] (1 superfamily)
    consists of two subdomains: four-helix bundle; and a 4-stranded mixed beta sheet (order 1342), 2nd strand is very short
  4. 2617804Superfamily d.388.1: Filoviridae VP35-like [267597] (2 families) (S)
    Pfam PF02097; PubMed 19122151
  5. 2617873Family d.388.1.0: automated matches [354863] (1 protein)
    not a true family
  6. 2617874Protein automated matches [354864] (1 species)
    not a true protein
  7. 2617875Species Myotis lucifugus [TaxId:59463] [354865] (1 PDB entry)
  8. 2617876Domain d6dkua_: 6dku A: [354866]
    automated match to d4ijfa_
    mutant

Details for d6dkua_

PDB Entry: 6dku (more details), 2.6 Å

PDB Description: crystal structure of myotis vp35 mutant of interferon inhibitory domain
PDB Compounds: (A:) vp35

SCOPe Domain Sequences for d6dkua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dkua_ d.388.1.0 (A:) automated matches {Myotis lucifugus [TaxId: 59463]}
rlpldptefvrvltgyltgprtafhelvsaiamvsrdshdlqvamdhfnrelmdgfsaha
aiisitqrceyfrnceapttqvtsksqiprayhrrlrdvpegpktlgrgwvyiyltpegs
lglki

SCOPe Domain Coordinates for d6dkua_:

Click to download the PDB-style file with coordinates for d6dkua_.
(The format of our PDB-style files is described here.)

Timeline for d6dkua_: