Class a: All alpha proteins [46456] (289 folds) |
Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.11.2: Second domain of FERM [47031] (2 families) automatically mapped to Pfam PF00373 |
Family a.11.2.0: automated matches [254193] (1 protein) not a true family |
Protein automated matches [254423] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255207] (60 PDB entries) |
Domain d6cdsa2: 6cds A:104-214 [354849] Other proteins in same PDB: d6cdsa1, d6cdsa3, d6cdsb1, d6cdsb3 automated match to d1isna1 complexed with gol, peg, pio, po4 |
PDB Entry: 6cds (more details), 2.62 Å
SCOPe Domain Sequences for d6cdsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cdsa2 a.11.2.0 (A:104-214) automated matches {Human (Homo sapiens) [TaxId: 9606]} naeeelvqeitqhlfflqvkkqildekiycppeasvllasyavqakygdydpsvhkrgfl aqeellpkrvinlyqmtpemweeritawyaehrgrardeaemeylkiaqdl
Timeline for d6cdsa2: