SCOPe 2.07: Domain d5xwea_: 5xwe A:

Lineage for d5xwea_ (5xwe A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.0: automated matches [191613] (1 protein)
   not a true family

6. Protein automated matches [191119] (7 species)
   not a true protein

7. Species King cobra (Ophiophagus hannah) [TaxId:8665] [189185] (2 PDB entries)

8. Domain d5xwea_: 5xwe A: [354751]
   automated match to d1tfsa_
   complexed with cl, gly, zn

Details for d5xwea_

PDB Entry: 5xwe, 1.8 Å

PDB Description: structure of a three finger toxin from ophiophagus hannah venom

PDB Compounds: (A:) Weak toxin DE-1 homolog 1

SCOPe Domain Sequences for d5xwea_:

Sequence, based on SEQRES records:

>d5xwea_ g.7.1.0 (A:) automated matches {King cobra (Ophiophagus hannah) [TaxId: 8665]}
riclkqepfqpettttcpegedacynlfwsdhseikiemgcgcpktepytnlycckidsc
nk

Sequence, based on observed residues (ATOM records):

>d5xwea_ g.7.1.0 (A:) automated matches {King cobra (Ophiophagus hannah) [TaxId: 8665]}
riclkqettttcpegedacynlfwkiemgcgcpktepytnlycckidscnk

Timeline for d5xwea_:

• d5xwea_ is new in SCOPe 2.07-stable
  
• d5xwea_ appears in the current release, SCOPe 2.08