Lineage for d5y8ib1 (5y8i B:1-159)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2456141Species Mycobacterium tuberculosis [TaxId:83332] [186789] (19 PDB entries)
  8. 2456163Domain d5y8ib1: 5y8i B:1-159 [354735]
    Other proteins in same PDB: d5y8ia2, d5y8ib2, d5y8ib3
    automated match to d1yb4a1
    complexed with 9on, gol, hui

Details for d5y8ib1

PDB Entry: 5y8i (more details), 2.04 Å

PDB Description: mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + (s)-3-hydroxyisobutyrate (s-hiba)
PDB Compounds: (B:) Probable 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d5y8ib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y8ib1 c.2.1.0 (B:1-159) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mttiaflglgnmgapmsanlvgaghvvrgfdpaptaasgaaahgvavfrsapeavaeadv
vitmlptgevvrrcytdvlaaarpatlfidsstisvtdarevhalaeshgmlqldapvsg
gvkgaaaatlafmvggdestlrrarpvlepmagkiihcg

SCOPe Domain Coordinates for d5y8ib1:

Click to download the PDB-style file with coordinates for d5y8ib1.
(The format of our PDB-style files is described here.)

Timeline for d5y8ib1: