Class b: All beta proteins [48724] (178 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.2: Pepsin-like [50646] (11 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
Protein automated matches [190156] (5 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [354698] (5 PDB entries) |
Domain d5yiaa_: 5yia A: [354713] automated match to d1leea_ complexed with 8v9, cps, gol, po4 |
PDB Entry: 5yia (more details), 2 Å
SCOPe Domain Sequences for d5yiaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yiaa_ b.50.1.2 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]} sndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlydss ksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastfd gilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyegp ltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvpf lpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfil gdpfmrkyftvfdydnqsvgialakknl
Timeline for d5yiaa_: