Class b: All beta proteins [48724] (178 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) |
Family b.3.4.0: automated matches [191441] (1 protein) not a true family |
Protein automated matches [190651] (8 species) not a true protein |
Species Sparus aurata [TaxId:8175] [354553] (7 PDB entries) |
Domain d6gnpd_: 6gnp D: [354683] automated match to d1bzda_ complexed with f4z |
PDB Entry: 6gnp (more details), 2.02 Å
SCOPe Domain Sequences for d6gnpd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gnpd_ b.3.4.0 (D:) automated matches {Sparus aurata [TaxId: 8175]} cplmvkildavkgtpagsvalkvsqktadggwtqiatgvtdatgeihnliteqqfpagvy rvefdtkaywtnqgstpfhevaevvfdahpeghrhytlalllspfsytttavvs
Timeline for d6gnpd_: