Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein automated matches [190118] (17 species) not a true protein |
Species Daphnia magna [TaxId:35525] [354543] (2 PDB entries) |
Domain d6fx4d_: 6fx4 D: [354544] automated match to d3rula_ complexed with gol |
PDB Entry: 6fx4 (more details), 2.5 Å
SCOPe Domain Sequences for d6fx4d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fx4d_ d.15.1.1 (D:) automated matches {Daphnia magna [TaxId: 35525]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgc
Timeline for d6fx4d_: