Lineage for d6dxna1 (6dxn A:34-222)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2487835Species Klebsiella pneumoniae [TaxId:573] [354497] (1 PDB entry)
  8. 2487836Domain d6dxna1: 6dxn A:34-222 [354498]
    Other proteins in same PDB: d6dxna2, d6dxnb2, d6dxnc2, d6dxnd2
    automated match to d4ocea_
    complexed with pge

Details for d6dxna1

PDB Entry: 6dxn (more details), 1.95 Å

PDB Description: 1.95 angstrom resolution crystal structure of dsba disulfide interchange protein from klebsiella pneumoniae.
PDB Compounds: (A:) thiol:disulfide interchange protein

SCOPe Domain Sequences for d6dxna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dxna1 c.47.1.0 (A:34-222) automated matches {Klebsiella pneumoniae [TaxId: 573]}
kdyqagknftvihstvkqppplveffsfycgpcyafaerinvdtairkrlpddmklekyh
vsqmgplgpalteawavaqyagvdgkvekllfeglqvkrdiktaadivkvfnqlgitsek
yaemqsnfmvkaliarqdnlvekmkvhgtpsfyvsgkyhinnaslaqddydtyaedmanl
vlfllnkpl

SCOPe Domain Coordinates for d6dxna1:

Click to download the PDB-style file with coordinates for d6dxna1.
(The format of our PDB-style files is described here.)

Timeline for d6dxna1: