Lineage for d5nznd_ (5nzn D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2417088Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2417089Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2417611Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2417612Protein automated matches [190692] (20 species)
    not a true protein
  7. 2417816Species Unidentified influenza virus [TaxId:11309] [354282] (4 PDB entries)
  8. 2417824Domain d5nznd_: 5nzn D: [354290]
    automated match to d5huga_
    complexed with bma, ca, edo, fuc, g39, nag; mutant

Details for d5nznd_

PDB Entry: 5nzn (more details), 1.73 Å

PDB Description: complex of h275y/s247n mutant variant of neuraminidase from h1n1 influenza virus with oseltamivir
PDB Compounds: (D:) Neuraminidase

SCOPe Domain Sequences for d5nznd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nznd_ b.68.1.0 (D:) automated matches {Unidentified influenza virus [TaxId: 11309]}
svklagnsslcpvsgwaiyskdnsvrigskgdvfvirepfiscsplecrtffltqgalln
dkhsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdng
avavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpnngqasykifriekg
kivksvemnapnyyyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgi
fgdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwt
gtdnnfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgs
sisfcgvnsdtvgwswpdgaelpftid

SCOPe Domain Coordinates for d5nznd_:

Click to download the PDB-style file with coordinates for d5nznd_.
(The format of our PDB-style files is described here.)

Timeline for d5nznd_: