SCOPe 2.07: Domain d6a0xd1: 6a0x D:1-107

Lineage for d6a0xd1 (6a0x D:1-107)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (29 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
Domain d6a0xd1: 6a0x D:1-107 [354199]
Other proteins in same PDB: d6a0xb2, d6a0xd2, d6a0xf2, d6a0xh2
automated match to d1a5fl1

Details for d6a0xd1

PDB Entry: 6a0x (more details), 2.3 Å

PDB Description: crystal structure of broadly neutralizing antibody 13d4

PDB Compounds: (D:) Antibody 13D4, Fab Light Chain

SCOPe Domain Sequences for d6a0xd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a0xd1 b.1.1.0 (D:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqsqkfmsasvgdrvsvtckasqnvgthlawyqqkpgqspkaliysasyrysgvpd
rftgsgsgtdftltisnvqsgdladyfcqqynnfpltfgagtkleik

SCOPe Domain Coordinates for d6a0xd1:

Click to download the PDB-style file with coordinates for d6a0xd1.
(The format of our PDB-style files is described here.)

Timeline for d6a0xd1: