Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (50 species) not a true protein |
Species Plasmodium falciparum [TaxId:5843] [354073] (9 PDB entries) |
Domain d5zh4a1: 5zh4 A:77-224 [354093] Other proteins in same PDB: d5zh4a2, d5zh4b2 automated match to d3bjua1 complexed with 9cc, cl, lys |
PDB Entry: 5zh4 (more details), 2.6 Å
SCOPe Domain Sequences for d5zh4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zh4a1 b.40.4.0 (A:77-224) automated matches {Plasmodium falciparum [TaxId: 5843]} evdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnit grimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfp gkskkgelsifpketillsaclhmlpmk
Timeline for d5zh4a1: