Lineage for d3pmga1 (3pmg A:1-190)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 185692Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
  4. 185693Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (1 family) (S)
  5. 185694Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins)
  6. 185709Protein Phosphoglucomutase [53740] (1 species)
  7. 185710Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53741] (6 PDB entries)
  8. 185711Domain d3pmga1: 3pmg A:1-190 [35408]
    Other proteins in same PDB: d3pmga4, d3pmgb4

Details for d3pmga1

PDB Entry: 3pmg (more details), 2.4 Å

PDB Description: structure of rabbit muscle phosphoglucomutase at 2.4 angstroms resolution. use of freezing point depressant and reduced temperature to enhance diffractivity

SCOP Domain Sequences for d3pmga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pmga1 c.84.1.1 (A:1-190) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus)}
vkivtvktkaypdqkpgtsglrkrvkvfqsstnyaenfiqsiistvepaqrqeatlvvgg
dgrfymkeaiqlivriaaangigrlvigqngilstpavsciirkikaiggiiltashnpg
gpngdfgikfnisnggpapeaitdkifqisktieeyaicpdlkvdlgvlgkqqfdlenkf
kpftveivds

SCOP Domain Coordinates for d3pmga1:

Click to download the PDB-style file with coordinates for d3pmga1.
(The format of our PDB-style files is described here.)

Timeline for d3pmga1: