SCOPe 2.07: Domain d5vz1c2: 5vz1 C:109-213

Lineage for d5vz1c2 (5vz1 C:109-213)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d5vz1c2: 5vz1 C:109-213 [354057]
   Other proteins in same PDB: d5vz1a1, d5vz1c1
   automated match to d4jg1l2
   complexed with zn

Details for d5vz1c2

PDB Entry: 5vz1, 2.11 Å

PDB Description: crystal structure of the apo antibody fragment (fab) raised against c- terminal domain of ebola nucleoprotein (ebov, tafv, bdbv strains)

PDB Compounds: (C:) Apo Antibody Fab Light Chain

SCOPe Domain Sequences for d5vz1c2:

Sequence; same for both SEQRES and ATOM records:

>d5vz1c2 b.1.1.2 (C:109-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d5vz1c2:

• d5vz1c2 is new in SCOPe 2.07-stable
  
• d5vz1c2 appears in the current release, SCOPe 2.08