Class b: All beta proteins [48724] (178 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
Protein automated matches [193506] (5 species) not a true protein |
Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries) |
Domain d5o8te_: 5o8t E: [353945] automated match to d2w8gc_ complexed with nag, sy9 |
PDB Entry: 5o8t (more details), 2.2 Å
SCOPe Domain Sequences for d5o8te_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o8te_ b.96.1.0 (E:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]} qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyeqqrwkl nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt rqvqhysccpepyidvnlvvkfrer
Timeline for d5o8te_:
View in 3D Domains from other chains: (mouse over for more information) d5o8ta_, d5o8tb_, d5o8tc_, d5o8td_ |