Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) |
Family d.73.1.0: automated matches [336551] (1 protein) not a true family |
Protein automated matches [336552] (9 species) not a true protein |
Species Skeletonema marinoi [TaxId:267567] [353912] (1 PDB entry) |
Domain d6ftll_: 6ftl L: [353918] Other proteins in same PDB: d6ftla1, d6ftla2, d6ftlc1, d6ftlc2, d6ftle1, d6ftle2, d6ftlg1, d6ftlg2 automated match to d1iwab_ complexed with cap, edo, mg |
PDB Entry: 6ftl (more details), 2.6 Å
SCOPe Domain Sequences for d6ftll_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ftll_ d.73.1.0 (L:) automated matches {Skeletonema marinoi [TaxId: 267567]} mrltqgcfsflpdltdaqiekqvayamakgwamnvewtddphprnnywelwglplfdikd patvmfelnearkscaagyirinafdasygvescvmsfitnrptnepgfyldrtdgpgrq ivysiksysvqanpegsry
Timeline for d6ftll_: