SCOPe 2.07: Domain d5xska_: 5xsk A:

Lineage for d5xska_ (5xsk A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.2: PWWP domain [69250] (6 proteins)
   includes the C-terminal all-alpha subdomain

6. Protein Hepatoma-derived growth factor, HDGF [117151] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [141211] (2 PDB entries)
   Uniprot Q8VHK7 1-110

8. Domain d5xska_: 5xsk A: [353807]
   automated match to d2b8aa1
   protein/DNA complex; complexed with mpd

Details for d5xska_

PDB Entry: 5xsk, 2.84 Å

PDB Description: crystal structure of pwwp-dna complex for human hepatoma-derived growth factor

PDB Compounds: (A:) Hepatoma-derived growth factor

SCOPe Domain Sequences for d5xska_:

Sequence; same for both SEQRES and ATOM records:

>d5xska_ b.34.9.2 (A:) Hepatoma-derived growth factor, HDGF {Norway rat (Rattus norvegicus) [TaxId: 10116]}
keykcgdlvfakmkgyphwparidempeaavkstankyqvfffgthetaflgpkdlfpye
eskekfgkpnkrkgfseglweiennptvka

Timeline for d5xska_:

• d5xska_ is new in SCOPe 2.07-stable
  
• d5xska_ appears in the current release, SCOPe 2.08