Lineage for d5xkha1 (5xkh A:1-245)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2471420Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2471421Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2471422Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2471549Protein automated matches [226837] (10 species)
    not a true protein
  7. 2471550Species Chicken (Gallus gallus) [TaxId:9031] [278810] (20 PDB entries)
  8. 2471559Domain d5xkha1: 5xkh A:1-245 [353762]
    Other proteins in same PDB: d5xkha2, d5xkhb2, d5xkhc2, d5xkhd2, d5xkhe_, d5xkhf1, d5xkhf2, d5xkhf3
    automated match to d5fnva1
    complexed with 89c, ca, gdp, gol, gtp, mes, mg

Details for d5xkha1

PDB Entry: 5xkh (more details), 2.25 Å

PDB Description: crystal structure of t2r-ttl-cf1 complex
PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5xkha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xkha1 c.32.1.1 (A:1-245) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

SCOPe Domain Coordinates for d5xkha1:

Click to download the PDB-style file with coordinates for d5xkha1.
(The format of our PDB-style files is described here.)

Timeline for d5xkha1: