SCOPe 2.07: Domain d6a12a_: 6a12 A:

Lineage for d6a12a_ (6a12 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
   lack the first two strands of the common fold

6. Protein automated matches [190277] (13 species)
   not a true protein

7. Species Geobacillus thermoleovorans [TaxId:33941] [353636] (1 PDB entry)

8. Domain d6a12a_: 6a12 A: [353637]
   automated match to d1ku0a_
   complexed with ca, zn

Details for d6a12a_

PDB Entry: 6a12, 2.15 Å

PDB Description: x-ray structure of lipase from geobacillus thermoleovorans

PDB Compounds: (A:) Lipase

SCOPe Domain Sequences for d6a12a_:

Sequence; same for both SEQRES and ATOM records:

>d6a12a_ c.69.1.18 (A:) automated matches {Geobacillus thermoleovorans [TaxId: 33941]}
srandapivllhgftgwgreemfgfkywggvrgdieqwlndngyrtytlavgplssnwdr
aceayaqlvggtvdygaahaakhgharfgrtypgllpelkrggrihiiahsqggqtarml
vsllengsqeereyakahnvslsplfegghhfvlsvttiatphdgttlvnmvdftdrffd
lqkavleaaavasnapytseiydfkldqwglrrepgesfdhyferlkrspvwtstdtary
dlsvpgaetlnrwvkaspntyylsfstertyrgaltgnyypelgmnafsaivcapflgsy
rnaalgidshwlendgivntismngpkrgssdrivpydgalkkgvwndmgtynvdhleii
gvdpnpsfdirafylrlaeqlaslrp

Timeline for d6a12a_:

• d6a12a_ is new in SCOPe 2.07-stable
  
• d6a12a_ appears in the current release, SCOPe 2.08