Lineage for d5oyho_ (5oyh O:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2561636Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2561717Family d.58.29.0: automated matches [191671] (1 protein)
    not a true family
  6. 2561718Protein automated matches [191274] (13 species)
    not a true protein
  7. 2561724Species Catenaria anguillulae [TaxId:765915] [353236] (2 PDB entries)
  8. 2561743Domain d5oyho_: 5oyh O: [353382]
    automated match to d6ao9a_
    complexed with ca, gol, t99

Details for d5oyho_

PDB Entry: 5oyh (more details), 2.25 Å

PDB Description: crystal structure of the catalytic core of a rhodopsin-guanylyl cyclase with converted specificity in complex with atpalphas
PDB Compounds: (O:) Nucleotide cyclase

SCOPe Domain Sequences for d5oyho_:

Sequence, based on SEQRES records: (download)

>d5oyho_ d.58.29.0 (O:) automated matches {Catenaria anguillulae [TaxId: 765915]}
eakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigday
lgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdlnp
hwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtywvt
ark

Sequence, based on observed residues (ATOM records): (download)

>d5oyho_ d.58.29.0 (O:) automated matches {Catenaria anguillulae [TaxId: 765915]}
eakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigday
lgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlphwdl
vgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtywvtark

SCOPe Domain Coordinates for d5oyho_:

Click to download the PDB-style file with coordinates for d5oyho_.
(The format of our PDB-style files is described here.)

Timeline for d5oyho_: