Lineage for d6c9md_ (6c9m D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2575571Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2575572Protein automated matches [190038] (48 species)
    not a true protein
  7. 2575675Species Human (Homo sapiens) [TaxId:9606] [225745] (54 PDB entries)
  8. 2575788Domain d6c9md_: 6c9m D: [353281]
    automated match to d5nnre_
    complexed with 1pe, ihp

Details for d6c9md_

PDB Entry: 6c9m (more details), 2.8 Å

PDB Description: the human nata (naa10/naa15) amino-terminal acetyltransferase complex
PDB Compounds: (D:) N-alpha-acetyltransferase 10

SCOPe Domain Sequences for d6c9md_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c9md_ d.108.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mnirnarpedlmnmqhcnllclpenyqmkyyfyhglswpqlsyiaedengkivgyvlakm
eedpddvphghitslavkrshrrlglaqklmdqasramienfnakyvslhvrksnraalh
lysntlnfqisevepkyyadgedayamkrdltqmadelrr

SCOPe Domain Coordinates for d6c9md_:

Click to download the PDB-style file with coordinates for d6c9md_.
(The format of our PDB-style files is described here.)

Timeline for d6c9md_: