Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (125 species) not a true protein |
Species Escherichia coli [TaxId:83333] [272137] (17 PDB entries) |
Domain d6cvma3: 6cvm A:334-625 [353155] Other proteins in same PDB: d6cvma1, d6cvma2, d6cvma4, d6cvma5, d6cvmb1, d6cvmb2, d6cvmb4, d6cvmb5, d6cvmc1, d6cvmc2, d6cvmc4, d6cvmc5, d6cvmd1, d6cvmd2, d6cvmd4, d6cvmd5 automated match to d1jz7a5 |
PDB Entry: 6cvm (more details), 1.9 Å
SCOPe Domain Sequences for d6cvma3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cvma3 c.1.8.0 (A:334-625) automated matches {Escherichia coli [TaxId: 83333]} vvriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d6cvma3:
View in 3D Domains from same chain: (mouse over for more information) d6cvma1, d6cvma2, d6cvma4, d6cvma5 |